kalaimahelhidayarisvishortstories.blogspot.com
கலைமகள் ஹிதாயா றிஸ்வியின் சிறுகதைகள்..
சனி, 6 ஆகஸ்ட், 2011. வெள்ளி பூத்து விடியும் வானம்! விஸ்மிக்கு தன் மகன் கியாஸின் போக்கு அறவே பிடிக்கவில்லை! எதிர்த்துப் பேசிச் சண்டை போடுமளவுக்கு வளர்ந்து (வந்து)விட்டான். எவ்வளவோ புத்திமதிகள் சொன்னாள் விஸ்மி.கியாஸ் செவிமடுக்கவேயில்ல! கியா(ஸ்)சையும் வளர்த்தாள்! நல்ல உடைகள் வாங்கிக் கொடுத்தாள்! படிக்க விட்டாள்! எல்லாவற்றையும் விட அன்பை அடைமழையாய் பொழிந்தாள்! செல்லமாய் வளர்த்தாள்! நீயும் ஒரு தாயா? மன்ரலியே அன்ஹு வாலிதா ஹுஃப அன அன்ஹு ரால...எவனாவது பெற்றோர்கள் ஒரĬ...எவன் பெற்றோர...அமைதிய...வீட...
kalaimahelhithayavinpaadalgal.blogspot.com
கலைமகள் ஹிதாயாவின் பாடல்கள்
திங்கள், 11 ஆகஸ்ட், 2014. ஆடுதடி கீத்து. தேடி வரும் காத்துக்கு ஆடுதடி கீத்து. ஒடி வந்து குயிலக்கா பாடுதடி பாட்டு. கும் மின்னு குதிச்சி சும்மா நீ ஆடடி. கொலையோட எள நீரு குடிக்கலாஞ் சேருடி. தந்தனா தந்தனா தன்னனானா. தானானேத் தானானே தன்னனானா. குத்தாலத் தண்ணீரு குளிரடிக்கும். கோமாரிப் பொன் அணைச்சா இதமளிக்கும். வத்தாது சமுத்திரம் அலை யடிக்கும். வஞ்சி நீ கொஞ்சினா சொகங் கெடைக்கும். தந்தனா தந்தனா தன்னனானே. தானானே தானானே தன்னனானே. கட்டான ஒடம்பில தெம்பிருக்கு. இடுகையிட்டது. 3:50 முற்பகல். ஊடக மென்பது...உன்...
kalaimahelinthaaivaakku.blogspot.com
கலைமகளின் தாய் வாக்கு
திங்கள், 9 மார்ச், 2015. தாய்வாக்கு - 128. தலைக்கணம் கொண்டு தன்னைத் தானேபோற்றிப் புகழ்பவன் - மகளே. சாதனைபுரிவதற்கு தகுதி அற்றவன். இடுகையிட்டது. 5:51 முற்பகல். கருத்துகள் இல்லை:. இதை மின்னஞ்சல் செய்க. Twitter இல் பகிர். Facebook இல் பகிர். Pinterest இல் பகிர். தாய்வாக்கு - 127. துன்பச்சுமைகளை சுமக்க முடிந்தவனுக்கு - மகளே. வாழ்க்கை ஒரு வரலாறு. இடுகையிட்டது. 5:50 முற்பகல். கருத்துகள் இல்லை:. இதை மின்னஞ்சல் செய்க. Twitter இல் பகிர். Facebook இல் பகிர். Pinterest இல் பகிர். 5:50 முற்பகல். நல்லோர&#...இதை...
kalaimakal.com
kalaimakal.com
Kalaimakal.com 2015 Privacy Policy Terms of Use. Participated at WeldIndia 2013. 7th to 9th Febuary 2013. Bangalore Trade Centre KTPO. Stand No. I03 and I04. Kalaimakal Systems deals with Laser Vision and Control systems for advanced welding and related automation. Kalaimakal in collaboration with Meta Vision Systems Ltd, United Kingdom supplies Laser Seam Finding, Tracking and Control systems. Kalaimakal has extensive knowledge on Meta products and customises to best suite Indian customer requirements.
kalaimakal.do.am
கலைமகள் செட்டிகுளம் வவுனியா - Kalaimakal
கல மகள ச ட ட க ளம வவ ன ய. உங கள ஆக கம. உங கள கர த த. தம ழர ச ய த கள. தம ழ ல எழ த வதற க. அற ந த க ள ள ங கள. ச ந தன த ள கள. க தலர ப ர த தம. க தலர ப ர வ தட க க. ம ன ப ர ட கள பத வ ற. தம ழ இண யங கள. ந ங கள அழக க இர க க. இன ய ல ல ம ச கம! சம யல க ற ப ப. தம ழ ல கல வ. ச த தமர த த வம. இல லற வ ழ க க இன த . ஒர ச ர யஸ கத : கட. ந ங கள உங கள நண பர கள க க தம ழ ல SMS அன ப ப வ ண ட ம. REGISTER HERE உற ப ப னர க இண வதற க. Create a free website.
kalaimakal.in
kalaimakal.in
Kalaimakal.in 2013 Privacy Policy Terms of Use. Kalaimakal Travels, headquartered in Krishnagiri, takes pride in showcasing India to tourists. Kalaimakal's service packages come with a clear understanding of the needs of all categories of tourists. With a flair for human relations and hospitality, Kalaimakal has grown to a gigantic organization under a dynamic management, ever sensitive to the constantly changing needs of its valued customers. For Kalaimakal Systems Please visit.
kalaimakalmahavidyalayam.com
மயிலிட்டி கலைமகள் மகா வித்தியாலயம் - முகபĮ
2990;யிலிட்டி கலைமகள் மகா வித்தியாலயம். 2990;ுகப்பு. 2949;றிவித்தல். 2965;ருத்துக்கள். 2949;ன்பான உறவுகளுக்கு வணக்கம்!
kalaimakalprintings.com
KalaiMakal Printings
We have acquired prominence in the domain of production and supply of useful collection of stickers like Cotton Stickers and Barcode Stickers. In addition to this, we are one of the finest service providers of various kinds of printing services like Silk Screen Printing, Multicolor Offset Printing, Die Cutting Services, Thermal Lamination Services and Offset and Screen Printing. New No. 28/Old No. 23,. 2nd Street,Mettupalayam,. PNRoad,Tirupur - 641602. Tamil Nadu, India. Powered by Sura Technologies.
kalaimalar.com
Kalai Malar — News Portal
ம வட டச ச ய த கள. ப ரம பல ர. ம ந லச ச ய த கள. த ச யச ச ய த கள. உலகச ச ய த கள. தங கள வர க க க நன ற! த ர தல ல வ ற ற ப ற வத ரண ல : ர ஜபச ச ம ட ய ல இர ந த க ற ய ம ன ன ள அம ச சர ல பரபரப ப. வ ஜயக ந த தல ம ய ல உண ண வ ரத அறப ப ர ட டம : த ம த க அற வ ப ப. மத த ய ம ந ல அரச கள கண ட த த 5 ம நகர ட ச கள ல மத ம க அறப ப ர : வ .க . ம னவர உடல ம ட க க ர ப ரதமர க க ஜ யலல த கட தம. இளம ப ண ண கடத த வ பச ரத த ல தள ள ய அக க – தங க க க தல 7 ஆண ட ச ற தண டன. ம ந லச ச ய த கள. August 10, 2015. August 10, 2015. August 10, 2015. இலங க ய...
kalaimanao.com
HostMonster
Web Hosting - courtesy of www.hostmonster.com.
kalaimanram.co.uk
Kalaimanram | Kalaimanram- Bharathanatiyam
Kalaimanram was founded by late W. M. Cumarasamy of Jaffna, father of Kalabhooshanam Shrimathy Thiripurasundari Yoganantham and Inaugurated by her Guru, Natya Kala Kesari Isai Perarignar Padmashri Vazhuvoor B. Ramaiah Pillai on the 21st of Oct 1958 after her Arangetram held on the 18th of October 1958 at the town hall Jaffna. Vazhuvoor Style of Dance. Kalaimanram was founded by late W.M Cumarasamy of Jaffna ,father of Kalabhooshanam shrimathy Thiripurasundari Yoganantham and Inaugurated by her guru, ...