livesimplylove.com
Live Simply LoveMarriage is God’s design; I believe it’s worth fighting for and telling the truth about.
http://www.livesimplylove.com/
Marriage is God’s design; I believe it’s worth fighting for and telling the truth about.
http://www.livesimplylove.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Monday
LOAD TIME
16x16
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
13
YEARS
3
MONTHS
18
DAYS
GODADDY.COM, LLC
WHOIS : whois.godaddy.com
REFERRED : http://registrar.godaddy.com
PAGES IN
THIS WEBSITE
20
SSL
EXTERNAL LINKS
216
SITE IP
104.200.22.130
LOAD TIME
0 sec
SCORE
6.2
Live Simply Love | livesimplylove.com Reviews
https://livesimplylove.com
Marriage is God’s design; I believe it’s worth fighting for and telling the truth about.
Writing, Feeling God’s Pleasure and the Unintended Sabbatical
http://www.livesimplylove.com/writing-unintended-sabbatical
Writing, Feeling God’s Pleasure and the Unintended Sabbatical. August 30, 2013. If you're new here, you may want to subscribe to my RSS feed. Hello Dear Reader,. It’s been a long time. And I’m finally ready to say it. My attempted return to blogging last fall failed. When I could no longer keep it up, I just quit. Not with any permanent intentions. It was just. A break. Necessary freedom from self-imposed pressure. Have you ever felt this way? The problem is, I love. Writing. Like really love it. Good wr...
What I Love Wednesdays!
http://www.livesimplylove.com/what-i-love-wednesdays-17
What I Love Wednesdays! July 4, 2012. If you're new here, you may want to subscribe to my RSS feed. All our local fireworks have been cancelled. Which makes sense because of the fires across the state of Colorado}. What are you doing for the 4th? Why not take a minute and send me an email. With a quick paragraph. Sharing what you love about your spouse. Here’s one from a reader for a little inspiration…. Jenny runs a blog over at Conscientious Confusion. You can do it! What happened with Arbonne? I might...
Make-Up-Monday: Marriage Lessons from the Driver’s Seat
http://www.livesimplylove.com/make-up-monday-marriage-lessons-from-the-drivers-seat
Make-Up-Monday: Marriage Lessons from the Driver’s Seat. August 6, 2012. If you're new here, you may want to subscribe to my RSS feed. Do you remember learning how to drive? With 20 years of experience under my belt. And now, finally a safe distance away from the wrecks and tickets of my teens and twenties}. I feel like I’m a pretty decent driver. I’ve almost always driven a car with a manual transmission, so when I was 15, that’s what Dad used to teach me. Sounds romantic, I KNOW! And just like learning...
What I Love Wednesdays!
http://www.livesimplylove.com/what-i-love-wednesdays-18
What I Love Wednesdays! July 11, 2012. If you're new here, you may want to subscribe to my RSS feed. Here’s a little What I Love Wednesdays. From Melissa, just days past their year anniversary! Happy Anniversary Melissa and Wyatt! Thanks for sharing a little bit of what you love with us today. My husband, Wyatt, (lovingly known as “Hubs” on my blog. And I have been married for just over 1 year now, and I can’t believe how fast the time has gone! On July 9, 2011, I truly did marry my best friend, and I...
What I Brought Into Marriage
http://www.livesimplylove.com/what-i-brought-into-marriage
What I Brought Into Marriage. October 24, 2013. If you're new here, you may want to subscribe to my RSS feed. In ancient times (and even today in some parts of the world), a bride brought a dowry usually property belonging to her parents into a marriage. The intent of a dowry was to provide future support for the bride and her children in the case of a husband’s untimely death. A few years ago. YAY! It was a dream-come-true because I have a LOT of stuff. But there’s something deep within this dysfunction...
TOTAL PAGES IN THIS WEBSITE
20
Preggersville | Chad Thomas Johnston
http://chadthomasjohnston.com/category/preggersville
Arts & (Hover)crafts. Chad Thomas Johnston / Saint Upid. Read Saint Upid’s Writings. Vlad’s Vlog 3: Revisiting the Zoo of My Childhood as an Adult. By Chad Thomas Johnston. On Jun 20, 2011. My parents used to take me to the Kansas City Zoo when I was a child. I remember it well (or at least I thought I did.). I used to beg to see the “flumbingoes” (Is that right, Mom and Dad? And the sea lions, and probably also wanted to take all of the colossal. Boys Have Wieners and Girls Have Hamburger Buns. Http:/ w...
Photogiraffes | Chad Thomas Johnston
http://chadthomasjohnston.com/category/photogiraffes
Arts & (Hover)crafts. Chad Thomas Johnston / Saint Upid. Read Saint Upid’s Writings. An Animated GIF Mother’s Day Card for Becki, from Evie and Me. By Chad Thomas Johnston. On May 8, 2014. Mama, I love you t-h-i-i-i-s-s-s much! You gave birth to me, so I know I’ll always be your little stinker. (Remember when I practiced my disco skunk moves before trick ‘r’ treating with Emma and Logan back in October? You give me a place to live. Although I sometime act like I would rather live. By Chad Thomas Johnston.
Rubblebucket Tours for “Omega La La” LP, Sings Omega Lullabye for Evie | Chad Thomas Johnston
http://chadthomasjohnston.com/2011/10/rubblebucket-tours-for-omega-la-la-lp-sings-omega-lullabye-for-evie
Arts & (Hover)crafts. Chad Thomas Johnston / Saint Upid. Read Saint Upid’s Writings. Putting the Cult in Culture. Rubblebucket Tours for “Omega La La” LP, Sings Omega Lullabye for Evie. By Chad Thomas Johnston. On Oct 22, 2011. Bull; 7:29 am. I was already off work this week, attempting to help the wife keep our almost 3-week-old daughter from sabotaging sanity and sleep alike, but it was Rubblebucket. On Wednesday, Rubblebucket headlined at the Bottleneck. I also got to interview band leader Alex Toth.
Muzack Morris | Chad Thomas Johnston
http://chadthomasjohnston.com/category/muzack-morris
Arts & (Hover)crafts. Chad Thomas Johnston / Saint Upid. Read Saint Upid’s Writings. My Review of Daniel Amos’s “Dig Here Said the Angel”. By Chad Thomas Johnston. On Nov 7, 2013. Denison Witmer Sings Evie to Sleep. By Chad Thomas Johnston. On Oct 3, 2013. Long Time, No Blog (Break Out the Yule Log). By Chad Thomas Johnston. On Nov 23, 2012. I am not dead. Neither is my blog. Although I really do not think of it as a blog anymore. It is a website that gathers all of my polished, pretty writin...ORIGIN OF...
Teacher Appreciation Week | 30 Blog
https://tara30before30.wordpress.com/2012/05/07/teacher-appreciation-week
Gonna do some Carpe Diem-ing! May 7, 2012. This article was in the NY Times last week: Teaching Me About Teaching. Who has since become Dr. Brand! As part of her passion for teaching writing, she also turned her classroom into a makeshift printing press and theater. We would write stories, she would type them up, then we would wrap wallpaper samples around pieces of cardboard creating the book’s cover, and finally bound our own books! 8211; 4th grade. 8211; 6th grade. 8211; 10th grade. Although Dr. G...
February | 2014 | onabreak
https://onabreak.wordpress.com/2014/02
I watch a lot of Friends. Archive for February, 2014. So, I’m 29…. I have a college degree, lived with the best girls/roommates/lasting friends, found a job that I love (and will hopefully get to do it again one day), been to 8 countries, lived in 4 states, found amazing friendships along the way, have a bangin husband, the coolest kid and a family who loves me. They’re pretty worth it. February 7, 2014. Fun in the sun. Create a free website or blog at WordPress.com. Blog at WordPress.com.
Colorado: We’ll meet again, one day! | onabreak
https://onabreak.wordpress.com/2012/10/17/california-chapter-1
I watch a lot of Friends. Colorado: We’ll meet again, one day! Is it me, or does it seem like every time I post it’s usually about some major life transition? Well, today is no different. I know that God is calling us to California right now. And I am SO excited to hang out with my family, friends and (let’s be honest) the beach! I don’t like goodbyes. Period. What I believe is God’s true blessing to us is that it’s also a “Hello! Haven’t seen you in awhile! 8221; to people we love and cherish. Notify me...
Just a mom.: July 2015
http://mammaserene.blogspot.com/2015_07_01_archive.html
No posts. Show all posts. No posts. Show all posts. Subscribe to: Posts (Atom). How to be a Mama. The Everyday Life of a Messy Housewife. The way it is. Sing like No One is Listening. Picture Window template. Powered by Blogger.
Made Like Madeley: Made Pioneer Woman's 16-Minute Chicken Quesadillas
http://madelikemadeley.blogspot.com/2013/02/made-pioneer-womans-16-minute-chicken.html
Wednesday, February 6, 2013. Made Pioneer Woman's 16-Minute Chicken Quesadillas. This is a short post for a short cook-time recipe. Such an easy weeknight meal! I also found that you do not have to make all the quesadillas in one night but if cooking for two make 2 quesadillas and refrigerate the remaining contents to make for lunch or dinner the next day - still as tasty! Subscribe to: Post Comments (Atom). Confessions of a Pioneer Woman. Elizabeth Ann's Recipe Box. Peeps and Ice Cream.
Just a mom.: Thy Will Be Done
http://mammaserene.blogspot.com/2015/04/thy-will-be-done.html
Sunday, April 12, 2015. Thy Will Be Done. Note: Only a member of this blog may post a comment. Subscribe to: Post Comments (Atom). A second to write. Ive Got a Little Army. Thy Will Be Done. How to be a Mama. The Everyday Life of a Messy Housewife. The way it is. Sing like No One is Listening. Picture Window template. Powered by Blogger.
TOTAL LINKS TO THIS WEBSITE
216
Live Simply Health Journals
Documenting your child’s Wellness Checks is going to be easy when using this section of the journal. The basic information given during these checks can be quickly documented while at the visit with your child’s doctor. We’ve made certain to include height, weight and even a space to write their percentile for each so you can make sure your child is on track. South Phoenix Healthy Start - Phoenix, AZ. Moonbeams - The Shops at Gainy Ranch - Scottsdale, AZ. Write Ons Etc. - Phoenix, AZ. This would make an ...
live simply | live simply. that's it.
March 20, 2014 · 6:48 pm. Yep – I’m building these. Even though our garden is well fenced, we always have interlopers. Perhaps these…. Http:/ www.grit.com/farm-and-garden/building-garden-fence-boxes.aspx#axzz2wWvo24jZ. September 14, 2013 · 2:21 pm. A wee miss calculation. Anyway, I have no shortage of things to do today. And tomorrow we’re butchering meat birds (so long as the wasps aren’t posing a problem). It will be a very full weekend. September 14, 2013 · 1:56 am. It’s still Flannelberry Friday.
live simply and simply live
Monday, June 20, 2016. Olive Miriam Asay joined our family on February 2, 2016 at 1:05 pm. She weighed 7 lbs 10 oz and was 20 inches long. If that date sounds familiar that's because it is- Olive shares a birthday with big sister, Scarlett. What was I supposed to do for 4 hours? Created by kira lee. Saturday, December 27, 2014. Created by kira lee. Labels: chaotic family togetherness. Wednesday, August 20, 2014. Where the heart is. Created by kira lee. Labels: chaotic family togetherness. On the fourth o...
livesimplylivehealthy.com
Welcome to: livesimplylivehealthy.com. This Web page is parked for FREE, courtesy of GoDaddy.com. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. THE domain at THE price. Visit GoDaddy.com for the best values on. Restrictions apply. See website for details.
livesimplylivethriftylivesavvy.com
Live Simply, Live Thrifty, Live Savvy | Life Lived Better
Live Simply, Live Thrifty, Live Savvy. About ‘Live Simply, Live Thrifty, Live Savvy’. Awards & Accolades. Let’s Get in Touch! 3 Health Benefits of Eating Soups. I’m very excited to announce that we have a guest blog post. However, eating soup on a regular basis doesn’t just protect you from a runny nose; there are various health benefits of this tasty meal. So, clear or thick, eating soups is beneficial for your well-being and we’ve taken it upon ourselves to note these 3 major health benefits of sou...
Live Simply Love
What I Brought Into Marriage. October 24, 2013. If you’re new here, you may want to subscribe to my RSS feed. Thanks for visiting! In ancient times (and even today in some parts of the world), a bride brought a dowry usually property belonging to her parents into a marriage. The intent of a dowry was to provide future support for the bride and her children […]. My Gift to the World. October 15, 2013. Writing, Feeling God’s Pleasure and the Unintended Sabbatical. August 30, 2013. September 19, 2012. Augus...
livesimplylovedeeply.wordpress.com
:: live simply :: love deeply ::
Live simply : love deeply :. Take a walk with me. Vulnerability and enemy love. January 24, 2014. I hear echoes of the tune’s melody, and I wonder what act of love, as simple as a few notes played on a trumpet, might lift me out of anger, out of hatred, and into the fullness and grace of love.”. 8212; Mariah Heglson (Commentary on the video above). September 8, 2013. So, i’m here in Vancouver with the Servants team. Orientation is starting tomorrow. In this shared language i don’t have to have a th...
Live Simply Love Generously | Live Simply Love Generously Devotional
Live Simply Love Generously. October 22, 2012 · 4:49 am. Overview of Week 4: Life. As we continue reading through Gordon MacDonald’s book, Generosity: moving toward life that is truly life, I wanted to provide an overview of what you will learn in Week 4. 8220;See also that you excel in the grace of giving” – 2 Corinthians 8:7. God says that everyone should excel in the grace of giving. Whether poor or rich, young or old…giving is for everyone. But how often do we celebrate those who do? Excellent planni...
livesimplylovepurely.wordpress.com
slow down. live simply. love purely. | this is my blog. sometimes i write things on it.
Slow down. live simply. love purely. This is my blog. sometimes i write things on it. November 15, 2015. November 15, 2015. 8220;You’re so tiny! I’ve heard this all my life. I heard it twice today. And I will hear it until my tiny bones are laid in a tiny casket in a tiny grave. I’ve always hated being called tiny. In my mind, “tiny” is synonymous with “weak,” and though I’ve been told over and over that this is not true, my brain can’t shake it. You’re tiny. You’re weak. I am small, but I am strong.
livesimplylovestrongly.blogspot.com
Live Simply, Love Strongly
Live Simply, Love Strongly. Saturday, June 25, 2011. Live Simply Love Strongly. Tuesday, June 21, 2011. Whole wheat pasta, eggplant and green beans chopped small in my Vitamix, garlic, salt, and fresh basil, oregano and thyme. I told Chili this was Monster food, and that monsters like it because it has lots of vitamins to make them strong and healthy ;) She ate it all! Check out more Traditional Tuesdays recipes here. Live Simply Love Strongly. Wednesday, June 15, 2011. Live Simply Love Strongly. See mor...
Live Simply Mommy
Monday, October 2, 2017. 5 Things: My Mind is on Food. After watching What the Health. My girls decided to go vegetarian. Of course, I had to follow suit as not to be tasked with making two meals per day. I have been experimenting with new vegetarian recipes, especially the recipes that can be frozen as I love to be able to make food ahead and save myself time and energy on week days. Two recipes are absolutely fantastic:. 1 White Bean Buffalo Soup. 2 Cheesy Broccoli Soup. Let the weekend begin! Beware: ...
SOCIAL ENGAGEMENT