livesimplylovepurely.wordpress.com
slow down. live simply. love purely. | this is my blog. sometimes i write things on it.this is my blog. sometimes i write things on it. (by AH)
http://livesimplylovepurely.wordpress.com/
this is my blog. sometimes i write things on it. (by AH)
http://livesimplylovepurely.wordpress.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Tuesday
LOAD TIME
1.9 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
13
SSL
EXTERNAL LINKS
2
SITE IP
192.0.78.13
LOAD TIME
1.875 sec
SCORE
6.2
slow down. live simply. love purely. | this is my blog. sometimes i write things on it. | livesimplylovepurely.wordpress.com Reviews
https://livesimplylovepurely.wordpress.com
this is my blog. sometimes i write things on it. (by AH)
livesimplylovepurely.wordpress.com
broken vessels | slow down. live simply. love purely.
https://livesimplylovepurely.wordpress.com/2015/05/29/broken-vessels
Slow down. live simply. love purely. This is my blog. sometimes i write things on it. May 29, 2015. May 30, 2015. There is a form of Japanese art called. In which a piece of broken pottery is taken and repaired using a binding agent mixed with gold or silver. Instead of throwing a once-valuable ceramic onto the garbage pile, it is taken in, all its broken pieces assessed, and carefully restored back to its original shape. But it was you. Who sought to steal, kill, and destroy. You. Did this to me, and you.
right hand held | slow down. live simply. love purely.
https://livesimplylovepurely.wordpress.com/2015/09/04/right-hand-held
Slow down. live simply. love purely. This is my blog. sometimes i write things on it. September 4, 2015. September 4, 2015. Photo by Jake Marsiglia / CC / altered. 8220;For I am the LORD your God who takes hold of your right hand and says to you, Do not fear; I will help you.”. But I noticed something the other day — something very slight, very subtle, but has profoundly changed the way I look at this verse and look at God:. For I am the LORD your God who takes hold of your. Take hold of it. Right hand, ...
tiny treasure | slow down. live simply. love purely.
https://livesimplylovepurely.wordpress.com/2015/11/15/tiny-treasure
Slow down. live simply. love purely. This is my blog. sometimes i write things on it. November 15, 2015. November 15, 2015. 8220;You’re so tiny! I’ve heard this all my life. I heard it twice today. And I will hear it until my tiny bones are laid in a tiny casket in a tiny grave. I’ve always hated being called tiny. In my mind, “tiny” is synonymous with “weak,” and though I’ve been told over and over that this is not true, my brain can’t shake it. You’re tiny. You’re weak. I am small, but I am strong.
Live Simply | slow down. live simply. love purely.
https://livesimplylovepurely.wordpress.com/live-simply
Slow down. live simply. love purely. This is my blog. sometimes i write things on it. The title for this blog comes from a poem I wrote years ago. I guess things haven’t changed much. I want to slow down. I want to live simply. I want to love purely. I want to serve. I want to give. I want to know. And I never want to settle for anything less. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Email (Address never made public). Top Posts and Pages.
rhythms | slow down. live simply. love purely.
https://livesimplylovepurely.wordpress.com/2015/08/20/rhythms
Slow down. live simply. love purely. This is my blog. sometimes i write things on it. August 20, 2015. September 4, 2015. Summer heat broke yesterday with the rain,. A gentle subdivision within the beat of the earth. Season’s changing, that’s for sure. And my body welcomes it. As a woman, I was created for seasons,. My flesh and blood propelled by cyclical movements. Of time, so when. My job has changed from school calendars to. Business academy rush,. I feel it wearing away my curves. And I am weary.
TOTAL PAGES IN THIS WEBSITE
13
viewfromgramarye.wordpress.com
What’s the Use in Denying It? | View from Gramarye
https://viewfromgramarye.wordpress.com/2015/02/21/whats-the-use-in-denying-it
A meeting place between worlds. About me (and Gramarye). A sheepish ode to the Chicago Manual of Style. Why I Choose a Life of Regret →. What’s the Use in Denying It? February 21, 2015. How do we grieve in exile? Taken the evening before I left West Africa permanently; age 19: with my sister. A coworker needs my bio for a webpage. I take pruning shears to an old one and notice it says nothing about where I live. No “makes her home in ” or “she lives with her husband in .”. It’s where I live. As I am care...
TOTAL LINKS TO THIS WEBSITE
2
livesimplylivehealthy.com
Welcome to: livesimplylivehealthy.com. This Web page is parked for FREE, courtesy of GoDaddy.com. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. THE domain at THE price. Visit GoDaddy.com for the best values on. Restrictions apply. See website for details.
livesimplylivethriftylivesavvy.com
Live Simply, Live Thrifty, Live Savvy | Life Lived Better
Live Simply, Live Thrifty, Live Savvy. About ‘Live Simply, Live Thrifty, Live Savvy’. Awards & Accolades. Let’s Get in Touch! 3 Health Benefits of Eating Soups. I’m very excited to announce that we have a guest blog post. However, eating soup on a regular basis doesn’t just protect you from a runny nose; there are various health benefits of this tasty meal. So, clear or thick, eating soups is beneficial for your well-being and we’ve taken it upon ourselves to note these 3 major health benefits of sou...
Live Simply Love
What I Brought Into Marriage. October 24, 2013. If you’re new here, you may want to subscribe to my RSS feed. Thanks for visiting! In ancient times (and even today in some parts of the world), a bride brought a dowry usually property belonging to her parents into a marriage. The intent of a dowry was to provide future support for the bride and her children […]. My Gift to the World. October 15, 2013. Writing, Feeling God’s Pleasure and the Unintended Sabbatical. August 30, 2013. September 19, 2012. Augus...
livesimplylovedeeply.wordpress.com
:: live simply :: love deeply ::
Live simply : love deeply :. Take a walk with me. Vulnerability and enemy love. January 24, 2014. I hear echoes of the tune’s melody, and I wonder what act of love, as simple as a few notes played on a trumpet, might lift me out of anger, out of hatred, and into the fullness and grace of love.”. 8212; Mariah Heglson (Commentary on the video above). September 8, 2013. So, i’m here in Vancouver with the Servants team. Orientation is starting tomorrow. In this shared language i don’t have to have a th...
Live Simply Love Generously | Live Simply Love Generously Devotional
Live Simply Love Generously. October 22, 2012 · 4:49 am. Overview of Week 4: Life. As we continue reading through Gordon MacDonald’s book, Generosity: moving toward life that is truly life, I wanted to provide an overview of what you will learn in Week 4. 8220;See also that you excel in the grace of giving” – 2 Corinthians 8:7. God says that everyone should excel in the grace of giving. Whether poor or rich, young or old…giving is for everyone. But how often do we celebrate those who do? Excellent planni...
livesimplylovepurely.wordpress.com
slow down. live simply. love purely. | this is my blog. sometimes i write things on it.
Slow down. live simply. love purely. This is my blog. sometimes i write things on it. November 15, 2015. November 15, 2015. 8220;You’re so tiny! I’ve heard this all my life. I heard it twice today. And I will hear it until my tiny bones are laid in a tiny casket in a tiny grave. I’ve always hated being called tiny. In my mind, “tiny” is synonymous with “weak,” and though I’ve been told over and over that this is not true, my brain can’t shake it. You’re tiny. You’re weak. I am small, but I am strong.
livesimplylovestrongly.blogspot.com
Live Simply, Love Strongly
Live Simply, Love Strongly. Saturday, June 25, 2011. Live Simply Love Strongly. Tuesday, June 21, 2011. Whole wheat pasta, eggplant and green beans chopped small in my Vitamix, garlic, salt, and fresh basil, oregano and thyme. I told Chili this was Monster food, and that monsters like it because it has lots of vitamins to make them strong and healthy ;) She ate it all! Check out more Traditional Tuesdays recipes here. Live Simply Love Strongly. Wednesday, June 15, 2011. Live Simply Love Strongly. See mor...
Live Simply Mommy
Monday, October 2, 2017. 5 Things: My Mind is on Food. After watching What the Health. My girls decided to go vegetarian. Of course, I had to follow suit as not to be tasked with making two meals per day. I have been experimenting with new vegetarian recipes, especially the recipes that can be frozen as I love to be able to make food ahead and save myself time and energy on week days. Two recipes are absolutely fantastic:. 1 White Bean Buffalo Soup. 2 Cheesy Broccoli Soup. Let the weekend begin! Beware: ...
livesimplymusic.com - Registered at Namecheap.com
This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! The Sponsored Listings displayed above are served automatically by a third party. Neither Parkingcrew nor the domain owner maintain any relationship with the advertisers.
Live Simply Natural by Vanessa Cassani
Check Out The Latest Post. Vegan Nopales & Corn Tacos. Natural Henna Tattoo Paste Recipe. Raw Key Lime Pie Bars (Vegan & Gluten Free). Make This For Dinner! Vegan Nopales & Corn Tacos. Creamy Cashew Indian Vegetable Curry. February 26, 2018. Yellow Split Pea Spinach Dahl. January 29, 2018. View All Dinner Post. Health Juice and Smoothie Recipes. How To: Build A Smoothie Bowl. September 25, 2017. The Ultimate Green Smoothie. December 21, 2016. Spinach Orange Green Juice. November 28, 2016. February 5, 2018.
Live Simply Now
Do you want to live a healthier more simplified life but you don't know where to start? It's not that hard if you take baby steps. Adding a good habit once a week while you subtract a bad one will make it easier to stick with than to make major changes all at once. Saturday, January 6, 2018. Sunday, March 12, 2017. It is almost mid March. Saturday, January 7, 2017. Are you glad the Holiday season is over? Wednesday, October 26, 2016. Is it over yet? Put all your energy into your candidate and rock on.
